Skip to main content
AI Watermark Removal

Research

Token Probability Watermarking

Token probability watermarking changes which word a model picks while it's still writing, nudging each sampling step toward a hidden pattern rather than stamping a finished page afterward. The mark gets built into word choice from the first token onward, which is exactly why the interesting attacks target the underlying rule rather than the finished text. One team needed under $50 in API queries to approximate a state-of-the-art scheme's secret rule, then used it to forge the watermark onto their own writing with over 80% success and strip it from real watermarked text with over 85% success.

Published 2026-08-11Updated 2026-08-11Research/proposal

Key takeaways

  • It operates on the model's logits or sampling step, before any text reaches the page, rather than stamping a finished document afterward.
  • Kirchenbauer and colleagues' 2023 green-list scheme, cited by nearly a thousand later papers, is the concrete academic example almost everything else in this space responds to or builds on.
  • Rival designs trade off the same properties differently: Kuditipudi and colleagues' distortion-free scheme leaves the model's output distribution mathematically unchanged, while Zhao and colleagues' Unigram-Watermark fixes the green/red split across all token positions for provable robustness to bounded editing.
  • Researchers showed in 2024 that a green-list-style watermark's secret rule can be approximated through public API queries for under $50, then used to spoof the watermark onto attacker-written text with over 80% success and to scrub it from real watermarked text, pushing scrubbing success from near 0% to over 85%.
  • Reddit users floated several guesses for how Claude's text watermark works, none confirmed by Anthropic's own announcement, and raised a fair, still-unresolved worry: whether nudging token choices is safe for generated code, where a changed token can break a program rather than just reword a sentence.

Green-list watermarking

How one real scheme nudges word choice

This is Kirchenbauer et al.'s foundational 2023 green-list scheme, the mechanism almost everything else in this space responds to or builds on. It is a real, published, academic technique, not a confirmed description of any specific provider's current text watermark.

1. Before the next word, the whole vocabulary splits into two lists

A pseudorandom function, seeded by a hash of the words already written plus a secret key, marks roughly half the vocabulary green and the rest red. This is a made-up illustrative sample, not a real list; the actual split is different at every position and unknown without the key.

thequicklysunnymightrainyperhapswarmdefinitelycloudysoon

2. Green candidates get a small, soft boost

The model already has a probability for each possible next word. Green candidates get a small bonus added before sampling. Bar length below stands for relative probability after that boost, not an exact published figure.

sunny
+boost
cloudy
rainy
+boost
warm

3. The model still samples normally, nothing is forced

"sunny" wins here because the boost pushed an already-strong candidate further ahead. If a red word's unboosted probability had been high enough, the model could still have picked it; the scheme nudges the odds, it does not filter out red words. Then the whole split re-shuffles for the word after this one, seeded by whatever was just chosen.

Why this is "soft," not a hard rule

Nothing in this scheme ever blocks a red-listed word outright. Text can still read naturally because the model keeps choosing whatever word actually fits best most of the time; the green bias just makes green words slightly likelier to win close calls. That's also why a single word or two proves nothing either way: the signal only becomes statistically visible once a detector can look at many tokens at once. See the dedicated statistical text watermarking page for how that scoring step works.

During generation, not after

You'll see exactly where in the pipeline the nudge sits, and why that placement decides which removal tricks work on it.

The watermark sits between the model's probability distribution and the token it finally outputs. It changes selection behavior, not the visible formatting of the finished paragraph.

DeepMind Technologies Limited filed a patent on March 20, 2024 describing exactly that for text, working in a succession of stages, each using its own pseudorandom function keyed to the preceding tokens and the candidate token, which preserves the output distribution in expectation while still leaving a statistically detectable trace. The patent never uses the word SynthID anywhere, though its inventor list is near-identical to the text-watermarking team DeepMind's own SynthID blog post credits.

That's part of why it survives copy-paste in a way a hidden character would not. There's no separate layer to strip, so normalizing the text or editing a metadata field does nothing to it.

Scoring the resulting pattern is a separate job, done later by whoever holds the key. This page is about the writing side.

The green list, and why everyone starts there

Research/proposal

Here's the concrete scheme almost every other paper in this field is arguing with.

Kirchenbauer, Geiping, Wen, Katz, Miers, and Goldstein's 2023 paper is the reference point, cited by nearly a thousand later papers. It proposes splitting a model's vocabulary into a green sublist and a red sublist before each token is generated.

The split is pseudorandom, seeded by the tokens that came just before it, so it shifts constantly through a document rather than staying fixed in place.

Sampling is then softly biased toward the green list. One token barely shows the effect, but a detector that knows the seeding rule can count how often word choices land in green versus red and run a statistical test on that ratio.

A later paper by some of the same authors found the signal held up after strong human paraphrasing once a detector could see roughly 800 tokens, at a false-positive rate of one in 100,000.

Not one recipe, a family of designs

Research/proposal

You'll see two rival constructions that trade off the same three properties differently, so you stop treating "token watermarking" as a single thing.

Not every scheme works by tilting the odds toward a green list. Kuditipudi, Thickstun, Hashimoto, and Liang proposed a different construction: generate text by mapping a secret sequence of pseudorandom numbers, derived from a watermark key, through the sampling procedure itself.

The model's overall output distribution comes out mathematically unchanged. No word is biased over another, and a detector that knows the key can still recover the watermark later.

The tradeoff moves rather than disappears. Robustness now depends on how much text survives editing relative to a length-based budget, not on how strongly word choices got tilted.

Zhao, Ananth, Li, and Wang went the other direction with Unigram-Watermark. They fix the green/red split so it stays constant across every token position instead of re-randomizing per token, and prove that makes the watermark robust to bounded editing and paraphrasing with guaranteed detection correctness.

Three properties are in tension in every one of these designs: detectability, text quality, and edit tolerance. Each scheme picks a different corner.

SynthID Text in production

Confirmed

Here's what Google actually ships, and where a March 2026 analysis says its own detector is structurally weakest.

Google's own production example works on the same underlying principle but places the nudge later in the pipeline, after Top-K and Top-P sampling have already narrowed the candidate pool. The Nature paper behind it describes a tournament-sampling design.

Google says the tool is open sourced for developers and that detection is score-based. A detector checks whether a passage's token choices match the configured pattern more often than chance would predict.

Google also says detector confidence can be greatly reduced by thorough rewriting or translation, while describing the scheme as robust to mild paraphrasing, for the Gemini app and web experience specifically. Whether the Gemini API applies the same watermarking is disputed in a Google-affiliated developer-forum reply, not settled by a primary source.

A March 2026 preprint pushes directly on a generation-side parameter. It proves that SynthID-Text's mean-scoring detection method becomes more vulnerable as the number of tournament sampling layers increases, demonstrates a matching attack, and shows the alternative Bayesian scoring method is provably more robust to that layer manipulation.

The rule can be stolen

Research/proposal

You'll see why attacking the splitting rule beats attacking the text, and what the defenders shipped back.

The green-list idea has a structural weak point. The split has to be reproducible by a detector, which means it follows a rule, and rules can sometimes be inferred from outside.

A 2024 ICML paper from ETH Zurich's SRI Lab showed exactly that. An attacker querying a provider's public API for under $50 total can approximate the secret green/red splitting rule closely enough to use it.

With that stolen approximation, the same researchers ran two attacks:

  • Spoofing: forging the watermark onto text the attacker wrote entirely themselves, succeeding more than 80% of the time with their strongest method.
  • Scrubbing: removing a real watermark from genuinely watermarked text, jumping from near 0% success to over 85%, in settings the original scheme's authors had assumed were safe.

Follow-up work complicates the picture in both directions. A 2025 ICLR paper showed a deployed scheme's family can be identified from limited black-box queries alone, evidence these schemes are more fingerprintable than assumed.

A separate 2025 paper from the same researchers built a statistical test that reliably tells genuinely watermarked text apart from text spoofed via a stolen rule. Today's spoofing attacks, including their own, leave detectable artifacts a defender can catch.

What people online guess about Claude's watermark

Community discussion

Here's the full list of mechanisms Reddit proposed, why none is confirmed, and the one worry nobody in this field has resolved.

When Anthropic announced that Claude embeds invisible watermarks in text output along with signed metadata on files, the recurring question in the r/singularity thread was simply how that works for text. Most people already understand image watermarks. Text isn't pixels.

Commenters guessed:

  • Hidden Unicode or invisible characters
  • Statistical word-choice patterns
  • Overrepresented n-grams
  • First-letter or sentence-position patterns
  • Token-probability nudges like the ones described above
  • A SynthID-like scheme, or a hybrid of several signals at once

None of these are confirmed. Anthropic's own announcement does not name a mechanism, so every theory above, including the token-probability one this page is about, is inference by analogy to Google's public work rather than a disclosed method.

The same thread raised a fair worry that stays genuinely unresolved anywhere in this space. Nudging token probabilities in prose changes a turn of phrase; nudging them in code could mean a different variable name, a flipped operator, or a broken build.

FAQ

Can a plain-text cleaner remove token probability watermarks?

Not directly. A statistical watermark is a pattern in wording, not a separate invisible character layer, so a tool built to strip hidden characters or metadata will not touch it.

Is Claude's text watermark the same mechanism as SynthID Text or the green-list scheme?

That is not confirmed. Reddit commenters guess it might work the same way, but Anthropic's own announcement does not name a mechanism, so treat any claimed link to SynthID or green-list-style watermarking as community speculation rather than a disclosed fact.

Can a token-probability watermark be stolen or forged?

Yes, at least for the academic green-list style scheme, and cheaply. A 2024 study approximated a provider's secret splitting rule using under $50 in API queries, then used it to forge the watermark onto attacker-written text with over 80% success and to strip it from real watermarked text with over 85% success. Follow-up research found a way to detect that kind of forgery, so the attack and the defense are both active areas rather than a settled question either way.

Next steps

  • Switch to the detection side and see the actual statistical test, the 800-token threshold, and the three-state verdict SynthID's own detector returns. Statistical text watermarking
  • Dig into forging specifically, including what a spoofed watermark can and can't be used for. AI watermark spoofing
  • Check what actually survives paraphrasing and translation, according to four independent audits rather than vendor marketing. Text watermark robustness
  • If your real problem is invisible characters pasted into a document, that's a completely different mechanism, and it takes seconds to strip in the browser. Free Unicode watermark remover

Sources and citation status